PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr9P12070_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 520aa    MW: 58423.4 Da    PI: 7.9919
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr9P12070_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS55.11.5e-17255344294
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                            ++lL++cAea+s+++ e+ + l ++ +  +s +g+p+qRl ay++e+L ar  +s++++y+al+++e +    se l++++++++++P
  GSMUA_Achr9P12070_001 255 KQLLIKCAEALSENKIEEFKLLAEEARSVVSISGEPIQRLGAYMLEGLVARHESSGTNIYHALRCREPE---GSELLSYMRILYDICP 339
                            689*****************************************************************9...9*************** PP

                   GRAS  90 ilkfs 94 
                            ++kf+
  GSMUA_Achr9P12070_001 340 YFKFG 344
                            ***96 PP

2GRAS219.51.7e-67345519198373
                   GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                            pgEalaVn+ lqlh+++desv+++++rd +L+lvk+lsPkv ++veqe+++n+++Fl+rf+e+l+yysa+f+s++++lpr+s+eri+v
  GSMUA_Achr9P12070_001 345 PGEALAVNFTLQLHHTPDESVDVNNPRDGLLRLVKGLSPKVTTLVEQESNTNTTPFLTRFVETLDYYSAMFESIDVTLPRDSKERINV 432
                            79************************************************************************************** PP

                   GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                            E+++l+++ivn++aceg++r+erhe l+kWr+rl++aGFkp+pls ++++ +k+ll  ++ d y + e++g+l+lgWk+r+L+s+SaW
  GSMUA_Achr9P12070_001 433 EQHCLAKDIVNIIACEGKDRIERHELLGKWRSRLSMAGFKPYPLSPYVNSVIKTLLGYYS-DKYALVEKDGTLLLGWKNRNLISASAW 519
                            ********************************************************9999.55************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035145.2E-15255344IPR005202Transcription factor GRAS
PROSITE profilePS5098527.486341501IPR005202Transcription factor GRAS
PfamPF035145.7E-65345519IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MPTVLSHPGS LLRRKAEWSG CSRSIPNLRD VIHGNQKHLD EPPSCSPRSI GSSEFLNPLA  60
HAVIVNQATS TPTGNASSLA TALLGNHVHH AASTPRFSHQ TDLQKSSAAV TCQKFGEKFV  120
KWESLEAHHL SKHAGIIEVT AIRILSRNNK QNRLVPSDSL YAVSRQSMRH ALHEIETVLM  180
APDTDEPTTS TSAEMTENKQ PPLTRQRSRT WTHATQLESA DRIHPHYLSG RCLNPEVRPE  240
KRQREMSYPP CDNVKQLLIK CAEALSENKI EEFKLLAEEA RSVVSISGEP IQRLGAYMLE  300
GLVARHESSG TNIYHALRCR EPEGSELLSY MRILYDICPY FKFGPGEALA VNFTLQLHHT  360
PDESVDVNNP RDGLLRLVKG LSPKVTTLVE QESNTNTTPF LTRFVETLDY YSAMFESIDV  420
TLPRDSKERI NVEQHCLAKD IVNIIACEGK DRIERHELLG KWRSRLSMAG FKPYPLSPYV  480
NSVIKTLLGY YSDKYALVEK DGTLLLGWKN RNLISASAWH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-31341520195375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015577067.11e-158PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 21
SwissprotQ69VG11e-104CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLM0TZL60.0M0TZL6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P12070_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92213141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.26e-90GRAS family protein